![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
![]() | Protein automated matches [227124] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226765] (9 PDB entries) |
![]() | Domain d4bcgb2: 4bcg B:151-259 [251199] Other proteins in same PDB: d4bcga_ automated match to d3mi9b2 complexed with gol, t3c |
PDB Entry: 4bcg (more details), 3.09 Å
SCOPe Domain Sequences for d4bcgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcgb2 a.74.1.0 (B:151-259) automated matches {Human (Homo sapiens) [TaxId: 9606]} dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw eipvstdgkhwweyvdatvtlelldelthellqilektpnrlkriwnwr
Timeline for d4bcgb2: