Class a: All alpha proteins [46456] (285 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.0: automated matches [227298] (1 protein) not a true family |
Protein automated matches [227124] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226765] (7 PDB entries) |
Domain d4bcgb1: 4bcg B:8-150 [251198] Other proteins in same PDB: d4bcga_ automated match to d3mi9b1 complexed with gol, t3c |
PDB Entry: 4bcg (more details), 3.08 Å
SCOPe Domain Sequences for d4bcgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bcgb1 a.74.1.0 (B:8-150) automated matches {Human (Homo sapiens) [TaxId: 9606]} nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl qqvqdlvilesiilqtlgfelti
Timeline for d4bcgb1: