Lineage for d4bcgb1 (4bcg B:8-150)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1495403Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1495404Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1495927Family a.74.1.0: automated matches [227298] (1 protein)
    not a true family
  6. 1495928Protein automated matches [227124] (1 species)
    not a true protein
  7. 1495929Species Human (Homo sapiens) [TaxId:9606] [226765] (7 PDB entries)
  8. 1495938Domain d4bcgb1: 4bcg B:8-150 [251198]
    Other proteins in same PDB: d4bcga_
    automated match to d3mi9b1
    complexed with gol, t3c

Details for d4bcgb1

PDB Entry: 4bcg (more details), 3.08 Å

PDB Description: structure of cdk9 in complex with cyclin t and a 2-amino-4-heteroaryl- pyrimidine inhibitor
PDB Compounds: (B:) Cyclin-T1

SCOPe Domain Sequences for d4bcgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bcgb1 a.74.1.0 (B:8-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh
rfymiqsftrfpgnsvapaalflaakvegqpkklehvikvahtclhpqeslpdtrseayl
qqvqdlvilesiilqtlgfelti

SCOPe Domain Coordinates for d4bcgb1:

Click to download the PDB-style file with coordinates for d4bcgb1.
(The format of our PDB-style files is described here.)

Timeline for d4bcgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bcgb2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bcga_