Lineage for d1prtb1 (1prt B:90-199)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949666Protein Pertussis toxin S2/S3 subunits, C-terminal domain [50213] (1 species)
    N-terminal domain in S2/S3 has C-lectin-like fold
  7. 949667Species Bordetella pertussis [TaxId:520] [50214] (3 PDB entries)
  8. 949668Domain d1prtb1: 1prt B:90-199 [25116]
    Other proteins in same PDB: d1prta_, d1prtb2, d1prtc2, d1prtd_, d1prte_, d1prtf_, d1prtg_, d1prth2, d1prti2, d1prtj_, d1prtk_, d1prtl_

Details for d1prtb1

PDB Entry: 1prt (more details), 2.9 Å

PDB Description: the crystal structure of pertussis toxin
PDB Compounds: (B:) pertussis toxin (subunit s2)

SCOPe Domain Sequences for d1prtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prtb1 b.40.2.1 (B:90-199) Pertussis toxin S2/S3 subunits, C-terminal domain {Bordetella pertussis [TaxId: 520]}
ttrntgqpatdhyysnvtatrllsstnsrlcavfvrsgqpvigactspydgkywsmysrl
rkmlyliyvagisvrvhvskeeqyydyedatfetyaltgisicnpgsslc

SCOPe Domain Coordinates for d1prtb1:

Click to download the PDB-style file with coordinates for d1prtb1.
(The format of our PDB-style files is described here.)

Timeline for d1prtb1: