Lineage for d4av7e2 (4av7 E:539-660)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968249Fold d.106: SCP-like [55717] (1 superfamily)
    alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145
  4. 2968250Superfamily d.106.1: SCP-like [55718] (5 families) (S)
  5. 2968313Family d.106.1.0: automated matches [191568] (1 protein)
    not a true family
  6. 2968314Protein automated matches [190987] (4 species)
    not a true protein
  7. 2968318Species Pseudomonas sp. [TaxId:1007495] [226383] (3 PDB entries)
  8. 2968323Domain d4av7e2: 4av7 E:539-660 [251156]
    Other proteins in same PDB: d4av7a1, d4av7a3, d4av7b1, d4av7b3, d4av7c1, d4av7c3, d4av7d1, d4av7d3, d4av7e1, d4av7e3, d4av7f1, d4av7f3
    automated match to d4axha2
    complexed with so4, zn; mutant

Details for d4av7e2

PDB Entry: 4av7 (more details), 3 Å

PDB Description: Structure determination of the double mutant S233Y F250G from the sec- alkyl sulfatase PisA1
PDB Compounds: (E:) sec-alkylsulfatase

SCOPe Domain Sequences for d4av7e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4av7e2 d.106.1.0 (E:539-660) automated matches {Pseudomonas sp. [TaxId: 1007495]}
gksemgraltpdmffdllairldtdkavghdmtlnwvfedlkqdialtlrngvltqrvgs
lnpkadvtvkltkptldqiaarkldlptaikqgtvkldgdgkklgeffglldsfspkfni
ve

SCOPe Domain Coordinates for d4av7e2:

Click to download the PDB-style file with coordinates for d4av7e2.
(The format of our PDB-style files is described here.)

Timeline for d4av7e2: