Class b: All beta proteins [48724] (176 folds) |
Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) |
Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
Protein automated matches [254673] (3 species) not a true protein |
Species Bacillus thuringiensis [TaxId:29339] [256190] (2 PDB entries) |
Domain d4arxb2: 4arx B:256-462 [251112] Other proteins in same PDB: d4arxa1, d4arxa3, d4arxb1, d4arxb3, d4arxc1, d4arxc3, d4arxd1, d4arxd3 automated match to d1ciya2 complexed with 13d, gol |
PDB Entry: 4arx (more details), 2.35 Å
SCOPe Domain Sequences for d4arxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4arxb2 b.77.2.0 (B:256-462) automated matches {Bacillus thuringiensis [TaxId: 29339]} pirtvsqltreiytnpvlenfdgsfrgsaqgiersirsphlmdilnsitiytdahrgyyy wsghqimaspvgfsgpeftfplygtmgnaapqqrivaqlgqgvyrtlsstlyrrpfnigi nnqqlsvldgtefaygtssnlpsavyrksgtvdsldeippqnnnvpprqgfshrlshvsm frsgfsnssvsiirapmfswihrsaef
Timeline for d4arxb2: