Lineage for d4anwa1 (4anw A:144-321)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178802Domain d4anwa1: 4anw A:144-321 [251087]
    Other proteins in same PDB: d4anwa2, d4anwa3, d4anwa4, d4anwa5
    automated match to d1e7ua3
    complexed with o92, so4

Details for d4anwa1

PDB Entry: 4anw (more details), 2.31 Å

PDB Description: complexes of pi3kgamma with isoform selective inhibitors.
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4anwa1:

Sequence, based on SEQRES records: (download)

>d4anwa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmakkkslmdipe
sqseqdfvlrvcgrdeylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

Sequence, based on observed residues (ATOM records): (download)

>d4anwa1 d.15.1.0 (A:144-321) automated matches {Human (Homo sapiens) [TaxId: 9606]}
seesqafqrqltaligydvtdvsnvhddeleftrrglvtprmaevasrdpklyamhpwvt
skplpeylwkkianncifivihrsttsqtikvspddtpgailqsfftkmeqdfvlrvcgr
deylvgetpiknfqwvrhclkngeeihvvldtppdpaldevrke

SCOPe Domain Coordinates for d4anwa1:

Click to download the PDB-style file with coordinates for d4anwa1.
(The format of our PDB-style files is described here.)

Timeline for d4anwa1: