SCOPe 2.07: Domain d4aiua3: 4aiu A:437-588

Lineage for d4aiua3 (4aiu A:437-588)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.0: automated matches [254242] (1 protein)
   not a true family

6. Protein automated matches [254554] (3 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:226186] [255269] (4 PDB entries)

8. Domain d4aiua3: 4aiu A:437-588 [251043]
   Other proteins in same PDB: d4aiua1, d4aiua2
   automated match to d2choa1
   complexed with ca, gc3

Details for d4aiua3

PDB Entry: 4aiu, 2.25 Å

PDB Description: A complex structure of BtGH84

PDB Compounds: (A:) o-glcnacase bt_4395

SCOPe Domain Sequences for d4aiua3:

Sequence, based on SEQRES records:

>d4aiua3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkt
atrvikplidrtfatvvkffnqkfnahldatt

Sequence, based on observed residues (ATOM records):

>d4aiua3 a.246.1.0 (A:437-588) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
reesmdiqpaaerflkafkegknydkadfetlqytfermkesadillmntenkpliveit
pwvhqfkltaemgeevlkmvernesyflrkynhvkalqqqmfyidqtsnqnpyqpgvkta
trvikplidrtfatvvkffnqkfnahldatt

Timeline for d4aiua3:

• d4aiua3 first appeared in SCOPe 2.04
  
• d4aiua3 appears in SCOPe 2.06
  
• d4aiua3 appears in the current release, SCOPe 2.08