Lineage for d1qnud_ (1qnu D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540595Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1540709Species Shigella dysenteriae, toxin I [TaxId:622] [50212] (3 PDB entries)
    identical sequence with verotoxin-1 B
  8. 1540713Domain d1qnud_: 1qnu D: [25104]
    complexed with emb, mec

Details for d1qnud_

PDB Entry: 1qnu (more details), 2.23 Å

PDB Description: shiga-like toxin i b subunit complexed with the bridged-starfish inhibitor
PDB Compounds: (D:) shiga-like toxin I b subunit

SCOPe Domain Sequences for d1qnud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qnud_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Shigella dysenteriae, toxin I [TaxId: 622]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1qnud_:

Click to download the PDB-style file with coordinates for d1qnud_.
(The format of our PDB-style files is described here.)

Timeline for d1qnud_: