SCOPe 2.08: Domain d4a73a1: 4a73 A:22-164

Lineage for d4a73a1 (4a73 A:22-164)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries)

8. Domain d4a73a1: 4a73 A:22-164 [250955]
   Other proteins in same PDB: d4a73a2, d4a73b2, d4a73c2, d4a73d2
   automated match to d2v7pa1
   mutant

Details for d4a73a1

PDB Entry: 4a73, 3 Å

PDB Description: single point mutant of thermus thermophilus lactate dehydrogenase

PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d4a73a1:

Sequence; same for both SEQRES and ATOM records:

>d4a73a1 c.2.1.0 (A:22-164) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mkvgivgsgmvgsatayalallgvarevvlvdldrklaqahaedilhatpfahpvwvrag
sygdlegaravvlaagvaqrpgetrlqlldrnaqvfaqvvprvleaapeavllvatnpvd
vmtqvayrlsglppgrvvgsg

Timeline for d4a73a1:

• d4a73a1 first appeared in SCOPe 2.04
  
• d4a73a1 appears in SCOPe 2.07