Lineage for d3zrdb_ (3zrd B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488487Species Yersinia pseudotuberculosis [TaxId:502800] [255688] (4 PDB entries)
  8. 2488489Domain d3zrdb_: 3zrd B: [250820]
    Other proteins in same PDB: d3zrda2
    automated match to d3p7xa_

Details for d3zrdb_

PDB Entry: 3zrd (more details), 1.74 Å

PDB Description: Oxidised Thiol peroxidase (Tpx) from Yersinia pseudotuberculosis
PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d3zrdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrdb_ c.47.1.0 (B:) automated matches {Yersinia pseudotuberculosis [TaxId: 502800]}
tqtvhfqgnpvsvagklpqigdkakdftlvakdlsdvalssfagkrkvlnifpsidtgvc
aasvrkfnqlagelentvvlcissdlpfaqsrfcgaeglsnvitlstlrgadfkqaygva
itegplagltaravvvldgqdnviyselvneittepnydaalaalk

SCOPe Domain Coordinates for d3zrdb_:

Click to download the PDB-style file with coordinates for d3zrdb_.
(The format of our PDB-style files is described here.)

Timeline for d3zrdb_: