Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (19 species) not a true protein |
Species Staphylococcus aureus [TaxId:158878] [256157] (3 PDB entries) |
Domain d3zg0a3: 3zg0 A:328-668 [250781] Other proteins in same PDB: d3zg0a1, d3zg0a2, d3zg0b1, d3zg0b2 automated match to d1vqqa3 complexed with 1w8, ai8, cd, cl, mur |
PDB Entry: 3zg0 (more details), 2.6 Å
SCOPe Domain Sequences for d3zg0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zg0a3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]} idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm mmainvkdvqdkgmasynakisgkvydelyengnkkydide
Timeline for d3zg0a3: