Lineage for d3zg0a3 (3zg0 A:328-668)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1690254Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1690900Protein automated matches [190161] (19 species)
    not a true protein
  7. 1691081Species Staphylococcus aureus [TaxId:158878] [256157] (3 PDB entries)
  8. 1691085Domain d3zg0a3: 3zg0 A:328-668 [250781]
    Other proteins in same PDB: d3zg0a1, d3zg0a2, d3zg0b1, d3zg0b2
    automated match to d1vqqa3
    complexed with 1w8, ai8, cd, cl, mur

Details for d3zg0a3

PDB Entry: 3zg0 (more details), 2.6 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by cocrystallization
PDB Compounds: (A:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zg0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zg0a3 e.3.1.1 (A:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d3zg0a3:

Click to download the PDB-style file with coordinates for d3zg0a3.
(The format of our PDB-style files is described here.)

Timeline for d3zg0a3: