Class b: All beta proteins [48724] (178 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.0: automated matches [191644] (1 protein) not a true family |
Protein automated matches [191182] (19 species) not a true protein |
Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries) |
Domain d3zeza_: 3zez A: [250766] automated match to d4gv8c_ complexed with dup, mg, ni, po4 |
PDB Entry: 3zez (more details), 2.8 Å
SCOPe Domain Sequences for d3zeza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zeza_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]} tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll tsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerhl yklgsyriekgeriaqlvivpiwtpelkqveefesvsergekgfgssgv
Timeline for d3zeza_: