Lineage for d3zeza_ (3zez A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2427208Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2427417Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2427616Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 2427617Protein automated matches [191182] (19 species)
    not a true protein
  7. 2427832Species Staphylococcus phage [TaxId:53369] [256154] (11 PDB entries)
  8. 2427834Domain d3zeza_: 3zez A: [250766]
    automated match to d4gv8c_
    complexed with dup, mg, ni, po4

Details for d3zeza_

PDB Entry: 3zez (more details), 2.8 Å

PDB Description: Phage dUTPases control transfer of virulence genes by a proto- oncogenic G protein-like mechanism.
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d3zeza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zeza_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefesvsergekgfgssgv

SCOPe Domain Coordinates for d3zeza_:

Click to download the PDB-style file with coordinates for d3zeza_.
(The format of our PDB-style files is described here.)

Timeline for d3zeza_: