Lineage for d3zdtb1 (3zdt B:35-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540276Species Chicken (Gallus gallus) [TaxId:9031] [254873] (2 PDB entries)
  8. 2540278Domain d3zdtb1: 3zdt B:35-130 [250759]
    Other proteins in same PDB: d3zdtb2, d3zdtb3
    automated match to d2al6b3
    mutant

Details for d3zdtb1

PDB Entry: 3zdt (more details), 3.15 Å

PDB Description: crystal structure of basic patch mutant fak ferm domain fak31- 405 k216a, k218a, r221a, k222a
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d3zdtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zdtb1 d.15.1.0 (B:35-130) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
rvlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqsee
vhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOPe Domain Coordinates for d3zdtb1:

Click to download the PDB-style file with coordinates for d3zdtb1.
(The format of our PDB-style files is described here.)

Timeline for d3zdtb1: