Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.0: automated matches [191343] (1 protein) not a true family |
Protein automated matches [190233] (31 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [254873] (2 PDB entries) |
Domain d3zdtb1: 3zdt B:35-130 [250759] Other proteins in same PDB: d3zdtb2, d3zdtb3 automated match to d2al6b3 mutant |
PDB Entry: 3zdt (more details), 3.15 Å
SCOPe Domain Sequences for d3zdtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zdtb1 d.15.1.0 (B:35-130) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} rvlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshlqsee vhwlhldmgvsnvrekfelahppeewkyelrirylp
Timeline for d3zdtb1: