Lineage for d3wo9a_ (3wo9 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1583821Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 1583886Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 1584080Family c.10.2.0: automated matches [191489] (1 protein)
    not a true family
  6. 1584081Protein automated matches [190787] (7 species)
    not a true protein
  7. 1584110Species Lethenteron camtschaticum [TaxId:980415] [256153] (1 PDB entry)
  8. 1584111Domain d3wo9a_: 3wo9 A: [250750]
    automated match to d2v9tb_

Details for d3wo9a_

PDB Entry: 3wo9 (more details), 2.3 Å

PDB Description: Crystal structure of the lamprey variable lymphocyte receptor C
PDB Compounds: (A:) Variable lymphocyte receptor C

SCOPe Domain Sequences for d3wo9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wo9a_ c.10.2.0 (A:) automated matches {Lethenteron camtschaticum [TaxId: 980415]}
hmaclavgkddictcsnktdsspetvdcsskkltavptgipanteklqldfnqlanipae
afhgltrltylaldynqlqslpvgvfdqlnnlnelrlqdnqltslppgvfdsltkltylt
lsqnqlqsipagvfdkltnlnrlelstnqlqsvphgafdslvnletlhlelnpwdcacsd
iiylrtfiakntdkisgmesaqcngtstavkdvntekiknvtc

SCOPe Domain Coordinates for d3wo9a_:

Click to download the PDB-style file with coordinates for d3wo9a_.
(The format of our PDB-style files is described here.)

Timeline for d3wo9a_: