| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
| Protein automated matches [190787] (7 species) not a true protein |
| Species Lethenteron camtschaticum [TaxId:980415] [256153] (1 PDB entry) |
| Domain d3wo9a_: 3wo9 A: [250750] automated match to d2v9tb_ |
PDB Entry: 3wo9 (more details), 2.3 Å
SCOPe Domain Sequences for d3wo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wo9a_ c.10.2.0 (A:) automated matches {Lethenteron camtschaticum [TaxId: 980415]}
hmaclavgkddictcsnktdsspetvdcsskkltavptgipanteklqldfnqlanipae
afhgltrltylaldynqlqslpvgvfdqlnnlnelrlqdnqltslppgvfdsltkltylt
lsqnqlqsipagvfdkltnlnrlelstnqlqsvphgafdslvnletlhlelnpwdcacsd
iiylrtfiakntdkisgmesaqcngtstavkdvntekiknvtc
Timeline for d3wo9a_: