Lineage for d3vrna3 (3vrn A:234-320)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2206459Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2206460Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2206931Family d.93.1.0: automated matches [191409] (1 protein)
    not a true family
  6. 2206932Protein automated matches [190561] (4 species)
    not a true protein
  7. 2206933Species Human (Homo sapiens) [TaxId:9606] [187549] (49 PDB entries)
  8. 2206936Domain d3vrna3: 3vrn A:234-320 [250665]
    Other proteins in same PDB: d3vrna1, d3vrna2
    automated match to d1b47a3
    complexed with ca

Details for d3vrna3

PDB Entry: 3vrn (more details), 1.64 Å

PDB Description: Crystal structure of the tyrosine kinase binding domain of Cbl-c
PDB Compounds: (A:) Signal transduction protein CBL-C

SCOPe Domain Sequences for d3vrna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vrna3 d.93.1.0 (A:234-320) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhpgymafltydevqerlqacrdkpgsyifrpsctrlgqwaigyvssdgsilqtipankp
lsqvllegqkdgfylypdgkthnpdlt

SCOPe Domain Coordinates for d3vrna3:

Click to download the PDB-style file with coordinates for d3vrna3.
(The format of our PDB-style files is described here.)

Timeline for d3vrna3: