SCOPe 2.07: Domain d3vklb2: 3vkl B:155-317

Lineage for d3vklb2 (3vkl B:155-317)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d3vklb2: 3vkl B:155-317 [250571]
   automated match to d3ap6d_
   complexed with bgc, edo, gal; mutant

Details for d3vklb2

PDB Entry: 3vkl, 2.55 Å

PDB Description: protease-resistant mutant form of human galectin-8 in complex with two lactose molecules

PDB Compounds: (B:) Galectin-8

SCOPe Domain Sequences for d3vklb2:

Sequence; same for both SEQRES and ATOM records:

>d3vklb2 b.29.1.0 (B:155-317) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmrlpfaarlntpmgpgrtvvvkgevnanaksfnvdllagkskdialhlnprlnikafv
rnsflqeswgeeernitsfpfspgmyfemiiycdvrefkvavngvhsleykhrfkelssi
dtleingdihllevrsw

Timeline for d3vklb2:

• d3vklb2 first appeared in SCOPe 2.04
  
• d3vklb2 appears in SCOPe 2.06
  
• d3vklb2 appears in the current release, SCOPe 2.08