Lineage for d1qohr_ (1qoh R:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1540281Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1540282Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1540595Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1540602Species Escherichia coli [TaxId:562] [50211] (14 PDB entries)
  8. 1540706Domain d1qohr_: 1qoh R: [25052]
    A mutant shiga-like toxin IIe
    mutant

Details for d1qohr_

PDB Entry: 1qoh (more details), 2.35 Å

PDB Description: a mutant shiga-like toxin iie
PDB Compounds: (R:) shiga-like toxin iie b subunit

SCOPe Domain Sequences for d1qohr_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qohr_ b.40.2.1 (R:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOPe Domain Coordinates for d1qohr_:

Click to download the PDB-style file with coordinates for d1qohr_.
(The format of our PDB-style files is described here.)

Timeline for d1qohr_: