Lineage for d1qohp_ (1qoh P:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166279Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 166496Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (2 species)
  7. 166497Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 166584Domain d1qohp_: 1qoh P: [25050]

Details for d1qohp_

PDB Entry: 1qoh (more details), 2.35 Å

PDB Description: a mutant shiga-like toxin iie

SCOP Domain Sequences for d1qohp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qohp_ b.40.2.1 (P:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
adcakgkiefskynedntftvkvsgreywtnrwnlqpllqsaqltgmtvtiisntcssgs
gfaevqfn

SCOP Domain Coordinates for d1qohp_:

Click to download the PDB-style file with coordinates for d1qohp_.
(The format of our PDB-style files is described here.)

Timeline for d1qohp_: