Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein beta-Galactosidase, domain 3 [51510] (3 species) |
Species Escherichia coli [TaxId:562] [51511] (46 PDB entries) Uniprot P00722 |
Domain d3vd4c3: 3vd4 C:334-625 [250390] Other proteins in same PDB: d3vd4a1, d3vd4a2, d3vd4a4, d3vd4a5, d3vd4b1, d3vd4b2, d3vd4b4, d3vd4b5, d3vd4c1, d3vd4c2, d3vd4c4, d3vd4c5, d3vd4d1, d3vd4d2, d3vd4d4, d3vd4d5 automated match to d1jz7a5 complexed with dms, ipt, mg, na |
PDB Entry: 3vd4 (more details), 2 Å
SCOPe Domain Sequences for d3vd4c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd4c3 c.1.8.3 (C:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv iiwslgdesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq
Timeline for d3vd4c3:
View in 3D Domains from same chain: (mouse over for more information) d3vd4c1, d3vd4c2, d3vd4c4, d3vd4c5 |