![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
![]() | Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
![]() | Protein beta-Galactosidase, domains 2 and 4 [49305] (3 species) |
![]() | Species Escherichia coli [TaxId:562] [49306] (46 PDB entries) Uniprot P00722 |
![]() | Domain d3vd4d4: 3vd4 D:626-730 [250396] Other proteins in same PDB: d3vd4a1, d3vd4a3, d3vd4a5, d3vd4b1, d3vd4b3, d3vd4b5, d3vd4c1, d3vd4c3, d3vd4c5, d3vd4d1, d3vd4d3, d3vd4d5 automated match to d1jz8a2 complexed with dms, ipt, mg, na |
PDB Entry: 3vd4 (more details), 2 Å
SCOPe Domain Sequences for d3vd4d4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vd4d4 b.1.4.1 (D:626-730) beta-Galactosidase, domains 2 and 4 {Escherichia coli [TaxId: 562]} ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3vd4d4:
![]() Domains from same chain: (mouse over for more information) d3vd4d1, d3vd4d2, d3vd4d3, d3vd4d5 |