Lineage for d3vd3c5 (3vd3 C:731-1023)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391262Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2391263Protein beta-Galactosidase, domain 5 [49996] (3 species)
  7. 2391271Species Escherichia coli [TaxId:562] [49997] (45 PDB entries)
    Uniprot P00722
  8. 2391394Domain d3vd3c5: 3vd3 C:731-1023 [250372]
    Other proteins in same PDB: d3vd3a1, d3vd3a2, d3vd3a3, d3vd3a4, d3vd3b1, d3vd3b2, d3vd3b3, d3vd3b4, d3vd3c1, d3vd3c2, d3vd3c3, d3vd3c4, d3vd3d1, d3vd3d2, d3vd3d3, d3vd3d4
    automated match to d1jz8a4
    complexed with dms, mg, na

Details for d3vd3c5

PDB Entry: 3vd3 (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460d)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3vd3c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd3c5 b.30.5.1 (C:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3vd3c5:

Click to download the PDB-style file with coordinates for d3vd3c5.
(The format of our PDB-style files is described here.)

Timeline for d3vd3c5: