Lineage for d3vd3b5 (3vd3 B:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2052584Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
    automatically mapped to Pfam PF02929
  6. 2052585Protein beta-Galactosidase, domain 5 [49996] (2 species)
  7. 2052593Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
    Uniprot P00722
  8. 2052719Domain d3vd3b5: 3vd3 B:731-1023 [250367]
    Other proteins in same PDB: d3vd3a1, d3vd3a2, d3vd3a3, d3vd3a4, d3vd3b1, d3vd3b2, d3vd3b3, d3vd3b4, d3vd3c1, d3vd3c2, d3vd3c3, d3vd3c4, d3vd3d1, d3vd3d2, d3vd3d3, d3vd3d4
    automated match to d1jz8a4
    complexed with dms, mg, na

Details for d3vd3b5

PDB Entry: 3vd3 (more details), 2.8 Å

PDB Description: e. coli (lacz) beta-galactosidase (n460d)
PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3vd3b5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vd3b5 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3vd3b5:

Click to download the PDB-style file with coordinates for d3vd3b5.
(The format of our PDB-style files is described here.)

Timeline for d3vd3b5: