Lineage for d1d1ke_ (1d1k E:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 373966Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 373967Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 374244Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (3 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 374245Species Escherichia coli [TaxId:562] [50211] (12 PDB entries)
  8. 374270Domain d1d1ke_: 1d1k E: [25034]
    complexed with gal, glc; mutant

Details for d1d1ke_

PDB Entry: 1d1k (more details), 2 Å

PDB Description: mutated shiga-like toxin b subunit (d17e/w34a) complexed with receptor gb3 analogue

SCOP Domain Sequences for d1d1ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1ke_ b.40.2.1 (E:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli}
tpdcvtgkveytkyndedtftvkvgdkelftnranlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOP Domain Coordinates for d1d1ke_:

Click to download the PDB-style file with coordinates for d1d1ke_.
(The format of our PDB-style files is described here.)

Timeline for d1d1ke_: