SCOPe 2.07: Domain d3v8ob2: 3v8o B:665-760

Lineage for d3v8ob2 (3v8o B:665-760)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (72 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186988] (10 PDB entries)

8. Domain d3v8ob2: 3v8o B:665-760 [250334]
   Other proteins in same PDB: d3v8oa3
   automated match to d2dj4a1
   complexed with k

Details for d3v8ob2

PDB Entry: 3v8o, 2.8 Å

PDB Description: Human Filamin C Ig - like Domains 4 and 5

PDB Compounds: (B:) Filamin-C

SCOPe Domain Sequences for d3v8ob2:

Sequence; same for both SEQRES and ATOM records:

>d3v8ob2 b.1.18.0 (B:665-760) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cfpdkvkafgpgleptgcivdkpaeftidaraagkgdlklyaqdadgcpidikvipngdg
tfrcsyvptkpikhtiiiswggvnvpkspfrvnvge

Timeline for d3v8ob2:

• d3v8ob2 first appeared in SCOPe 2.04
  
• d3v8ob2 appears in SCOPe 2.06
  
• d3v8ob2 appears in the current release, SCOPe 2.08