Lineage for d3v2hb1 (3v2h B:1-258)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2095904Species Sinorhizobium meliloti [TaxId:266834] [189876] (11 PDB entries)
  8. 2095939Domain d3v2hb1: 3v2h B:1-258 [250303]
    Other proteins in same PDB: d3v2ha2, d3v2hb2
    automated match to d3ksua_

Details for d3v2hb1

PDB Entry: 3v2h (more details), 3 Å

PDB Description: The crystal structure of D-beta-hydroxybutyrate dehydrogenase from Sinorhizobium meliloti
PDB Compounds: (B:) D-beta-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d3v2hb1:

Sequence, based on SEQRES records: (download)

>d3v2hb1 c.2.1.0 (B:1-258) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtktavitgstsgiglaiartlakaganivlngfgapdeirtvtdevaglssgtvlhhpa
dmtkpseiadmmamvadrfggadilvnnagvqfvekiedfpveqwdriiavnlsssfhti
rgaippmkkkgwgriiniasahglvaspfksayvaakhgimgltktvalevaesgvtvns
icpgyvltplvekqipdqartrgiteeqvinevmlkgqptkkfitveqvaslalylagdd
aaqitgthvsmdggwtaq

Sequence, based on observed residues (ATOM records): (download)

>d3v2hb1 c.2.1.0 (B:1-258) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
mtktavitgstsgiglaiartlakaganivlngfgapdeirtvtdevaglssgtvlhhpa
dmtkpseiadmmamvadrfggadilvnnagvqfvekiedfpveqwdriiavnlsssfhti
rgaippmkkkgwgriiniasahglvaspfksayvaakhgimgltktvalevaesgvtvns
icpgyvlgqptkkfitveqvaslalylagddaaqitgthvsmdggwtaq

SCOPe Domain Coordinates for d3v2hb1:

Click to download the PDB-style file with coordinates for d3v2hb1.
(The format of our PDB-style files is described here.)

Timeline for d3v2hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v2hb2