SCOPe 2.06: Domain d3v03a1: 3v03 A:3-195

Lineage for d3v03a1 (3v03 A:3-195)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.0: automated matches [254216] (1 protein)
   not a true family

6. Protein automated matches [254493] (6 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [256128] (4 PDB entries)

8. Domain d3v03a1: 3v03 A:3-195 [250287]
   automated match to d3jrya1
   complexed with act, ca

Details for d3v03a1

PDB Entry: 3v03, 2.7 Å

PDB Description: crystal structure of bovine serum albumin

PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d3v03a1:

Sequence; same for both SEQRES and ATOM records:

>d3v03a1 a.126.1.0 (A:3-195) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hkseiahrfkdlgeehfkglvliafsqylqqcpfdehvklvneltefaktcvadeshagc
ekslhtlfgdelckvaslretygdmadccekqepernecflshkddspdlpklkpdpntl
cdefkadekkfwgkylyeiarrhpyfyapellyyankyngvfqeccqaedkgacllpkie
tmrekvltssarq

Timeline for d3v03a1:

• d3v03a1 first appeared in SCOPe 2.04
  
• d3v03a1 appears in SCOPe 2.05
  
• d3v03a1 appears in SCOPe 2.07
  
• d3v03a1 appears in the current release, SCOPe 2.08