Lineage for d3uxyc_ (3uxy C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108677Species Rhodobacter sphaeroides [TaxId:272943] [256127] (1 PDB entry)
  8. 2108680Domain d3uxyc_: 3uxy C: [250285]
    automated match to d4bnzc_
    complexed with nad

Details for d3uxyc_

PDB Entry: 3uxy (more details), 2.1 Å

PDB Description: The crystal structure of short chain dehydrogenase from Rhodobacter sphaeroides
PDB Compounds: (C:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d3uxyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uxyc_ c.2.1.0 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
fegkvalvtgaaggiggavvtalraagarvavadravagiaadlhlpgdlreaayadglp
gavaaglgrldivvnnagvisrgritettdadwslslgvnveapfricraaiplmaaagg
gaivnvascwglrpgpghalycltkaalasltqcmgmdhapqgirinavcpnevntpmlr
tgfakrgfdpdravaelgrtvplgriaepediadvvlflasdaarylcgslvevnggkav
a

SCOPe Domain Coordinates for d3uxyc_:

Click to download the PDB-style file with coordinates for d3uxyc_.
(The format of our PDB-style files is described here.)

Timeline for d3uxyc_: