Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) |
Family d.218.1.0: automated matches [227287] (1 protein) not a true family |
Protein automated matches [227105] (4 species) not a true protein |
Species Zymomonas mobilis [TaxId:264203] [256125] (1 PDB entry) |
Domain d3upsa_: 3ups A: [250251] automated match to d2o5aa1 |
PDB Entry: 3ups (more details), 1.75 Å
SCOPe Domain Sequences for d3upsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3upsa_ d.218.1.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]} fdpemllklvtdsldddqaleiatiplagkssiadymviasgrssrqvtamaqkladrik aatgyvskieglpaadwvlldagdiiihlfrpevrsfynlermwgfgd
Timeline for d3upsa_: