Lineage for d3upsa_ (3ups A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1686016Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 1686017Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 1686428Family d.218.1.0: automated matches [227287] (1 protein)
    not a true family
  6. 1686429Protein automated matches [227105] (4 species)
    not a true protein
  7. 1686439Species Zymomonas mobilis [TaxId:264203] [256125] (1 PDB entry)
  8. 1686440Domain d3upsa_: 3ups A: [250251]
    automated match to d2o5aa1

Details for d3upsa_

PDB Entry: 3ups (more details), 1.75 Å

PDB Description: Crystal structure of iojap-like protein from Zymomonas mobilis
PDB Compounds: (A:) Iojap-like protein

SCOPe Domain Sequences for d3upsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3upsa_ d.218.1.0 (A:) automated matches {Zymomonas mobilis [TaxId: 264203]}
fdpemllklvtdsldddqaleiatiplagkssiadymviasgrssrqvtamaqkladrik
aatgyvskieglpaadwvlldagdiiihlfrpevrsfynlermwgfgd

SCOPe Domain Coordinates for d3upsa_:

Click to download the PDB-style file with coordinates for d3upsa_.
(The format of our PDB-style files is described here.)

Timeline for d3upsa_: