Lineage for d3uaod_ (3uao D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472415Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2472416Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2472469Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2472470Protein automated matches [190499] (25 species)
    not a true protein
  7. 2472489Species Bordetella bronchiseptica [TaxId:518] [256004] (2 PDB entries)
  8. 2472493Domain d3uaod_: 3uao D: [250183]
    automated match to d3hb7a_
    complexed with act

Details for d3uaod_

PDB Entry: 3uao (more details), 2.4 Å

PDB Description: Structure and Catalytic Mechanism of the Vitamin B3 Degradative Enzyme Maleamate Amidohydrolase from Bordetalla bronchiseptica RB50
PDB Compounds: (D:) Putative isochorismatase

SCOPe Domain Sequences for d3uaod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uaod_ c.33.1.0 (D:) automated matches {Bordetella bronchiseptica [TaxId: 518]}
gsyerqgfgaalplkapygllivdfvngfadpaqfgggniaaaiettrtvlaaarergwa
vahsrivyadddadgnifsikvpgmltlkehapasaivpqlapqageyvvrkstpsafyg
tmlaawlaqrgvqtllvagattsgcvrasvvdamsagfrplvlsdcvgdralgpheanlf
dmrqkyaavmthdealaktk

SCOPe Domain Coordinates for d3uaod_:

Click to download the PDB-style file with coordinates for d3uaod_.
(The format of our PDB-style files is described here.)

Timeline for d3uaod_: