Lineage for d1c48d_ (1c48 D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 949388Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 949389Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 949702Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 949709Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 949718Domain d1c48d_: 1c48 D: [25018]

Details for d1c48d_

PDB Entry: 1c48 (more details), 1.6 Å

PDB Description: mutated shiga-like toxin b subunit (g62t)
PDB Compounds: (D:) protein (shiga-like toxin I b subunit)

SCOPe Domain Sequences for d1c48d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c48d_ b.40.2.1 (D:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
gtfsevifr

SCOPe Domain Coordinates for d1c48d_:

Click to download the PDB-style file with coordinates for d1c48d_.
(The format of our PDB-style files is described here.)

Timeline for d1c48d_: