| Class b: All beta proteins [48724] (177 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (16 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [256112] (3 PDB entries) |
| Domain d3u6bb3: 3u6b B:297-393 [250092] Other proteins in same PDB: d3u6ba1, d3u6ba2, d3u6bb1, d3u6bb2 automated match to d1d8ta2 complexed with gdp, mg |
PDB Entry: 3u6b (more details), 2.12 Å
SCOPe Domain Sequences for d3u6bb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u6bb3 b.44.1.0 (B:297-393) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d3u6bb3: