SCOPe 2.06: Domain d3u5rh_: 3u5r H:

Lineage for d3u5rh_ (3u5r H:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Sinorhizobium meliloti [TaxId:266834] [256114] (1 PDB entry)

8. Domain d3u5rh_: 3u5r H: [250086]
   automated match to d2ywoa_

Details for d3u5rh_

PDB Entry: 3u5r, 2.05 Å

PDB Description: Crystal structure of a hypothetical protein SMc02350 from Sinorhizobium meliloti 1021

PDB Compounds: (H:) Uncharacterized protein

SCOPe Domain Sequences for d3u5rh_:

Sequence; same for both SEQRES and ATOM records:

>d3u5rh_ c.47.1.0 (H:) automated matches {Sinorhizobium meliloti [TaxId: 266834]}
ktqsnsitlgtraadfvlpdaggnlftlaefkdspallvafisnrcpfvvlirealakfa
gdyagqglavvainsndaqafpeetlervgaevkaygygfpylkdasqsvakaygaactp
dfflydrerrlvyhgqfddarpgngkdvtgadlraavdavlkgkdvgttqvpsigcnikw
tagn

Timeline for d3u5rh_:

• d3u5rh_ first appeared in SCOPe 2.04
  
• d3u5rh_ appears in SCOPe 2.05
  
• d3u5rh_ appears in SCOPe 2.07
  
• d3u5rh_ appears in the current release, SCOPe 2.08