Lineage for d3u0oa1 (3u0o A:29-162)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201987Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2202063Family d.79.4.0: automated matches [227181] (1 protein)
    not a true family
  6. 2202064Protein automated matches [226901] (9 species)
    not a true protein
  7. 2202078Species Escherichia coli K-12 [TaxId:83333] [256107] (1 PDB entry)
  8. 2202079Domain d3u0oa1: 3u0o A:29-162 [250060]
    Other proteins in same PDB: d3u0oa2, d3u0ob2
    automated match to d2yyea1
    complexed with mg

Details for d3u0oa1

PDB Entry: 3u0o (more details), 2.25 Å

PDB Description: The crystal structure of selenophosphate synthetase from E. coli
PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d3u0oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0oa1 d.79.4.0 (A:29-162) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ilhseqakfvdpnllvgnetrddaavydlgngtsvisttdffmpivdnpfdfgriaatna
isdifamggkpimaiailgwpinklspeiarevteggryacrqagialagghsidapepi
fglavtgivpterv

SCOPe Domain Coordinates for d3u0oa1:

Click to download the PDB-style file with coordinates for d3u0oa1.
(The format of our PDB-style files is described here.)

Timeline for d3u0oa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3u0oa2