| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
| Family d.79.4.0: automated matches [227181] (1 protein) not a true family |
| Protein automated matches [226901] (9 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [256107] (1 PDB entry) |
| Domain d3u0oa1: 3u0o A:29-162 [250060] Other proteins in same PDB: d3u0oa2, d3u0ob2 automated match to d2yyea1 complexed with mg |
PDB Entry: 3u0o (more details), 2.25 Å
SCOPe Domain Sequences for d3u0oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u0oa1 d.79.4.0 (A:29-162) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ilhseqakfvdpnllvgnetrddaavydlgngtsvisttdffmpivdnpfdfgriaatna
isdifamggkpimaiailgwpinklspeiarevteggryacrqagialagghsidapepi
fglavtgivpterv
Timeline for d3u0oa1: