SCOPe 2.05: Domain d3tz4a2: 3tz4 A:186-375

Lineage for d3tz4a2 (3tz4 A:186-375)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.4: alpha-ketoacid dehydrogenase kinase, C-terminal domain [69804] (3 proteins)

6. Protein automated matches [230554] (2 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [233755] (13 PDB entries)

8. Domain d3tz4a2: 3tz4 A:186-375 [250044]
   Other proteins in same PDB: d3tz4a1
   automated match to d3tz0a2
   complexed with 03h, adp, k, mg

Details for d3tz4a2

PDB Entry: 3tz4, 2.25 Å

PDB Description: crystal structure of branched-chain alpha-ketoacid dehydrogenase kinase/s-alpha-chloroisocaproate complex with adp

PDB Compounds: (A:) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial

SCOPe Domain Sequences for d3tz4a2:

Sequence, based on SEQRES records:

>d3tz4a2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
aeastqdprisplfghldmhsggqsgpmhgfgfglptsrayaeylggslqlqslqgigtd
vylrlrhidg

Sequence, based on observed residues (ATOM records):

>d3tz4a2 d.122.1.4 (A:186-375) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dfvgiictrlspkkiiekwvdfarrlcehkygnaprvringhvaarfpfipmpldyilpe
llknamratmeshldtpynvpdvvitianndvdliirisdrgggiahkdldrvmdyhftt
agfgfglptsrayaeylggslqlqslqgigtdvylrlrhidg

Timeline for d3tz4a2:

• d3tz4a2 first appeared in SCOPe 2.04
  
• d3tz4a2 appears in SCOPe 2.06
  
• d3tz4a2 appears in the current release, SCOPe 2.08