Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
Protein automated matches [226883] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries) |
Domain d3tu5b1: 3tu5 B:2-132 [250035] Other proteins in same PDB: d3tu5a1, d3tu5a2, d3tu5b2 automated match to d1t44g_ complexed with atp, ca, mpd |
PDB Entry: 3tu5 (more details), 3 Å
SCOPe Domain Sequences for d3tu5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tu5b1 d.109.1.1 (B:2-132) automated matches {Human (Homo sapiens) [TaxId: 9606]} vvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqydl hywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkggv asklrkvaeqt
Timeline for d3tu5b1: