Lineage for d3tqyb_ (3tqy B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2400006Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 2400007Protein automated matches [190576] (50 species)
    not a true protein
  7. 2400059Species Coxiella burnetii [TaxId:777] [233711] (2 PDB entries)
  8. 2400061Domain d3tqyb_: 3tqy B: [249991]
    automated match to d3ullb_

Details for d3tqyb_

PDB Entry: 3tqy (more details), 2.6 Å

PDB Description: structure of a single-stranded dna-binding protein (ssb), from coxiella burnetii
PDB Compounds: (B:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3tqyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqyb_ b.40.4.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
argvnkvilignlgqdpevrytpngnavanvtlatsttwrdkqtgelqertewhriaffn
rlaeivgeylrkgskiyiegslrtrkwqdkngvdrytteiianemhmld

SCOPe Domain Coordinates for d3tqyb_:

Click to download the PDB-style file with coordinates for d3tqyb_.
(The format of our PDB-style files is described here.)

Timeline for d3tqyb_: