Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein automated matches [190228] (21 species) not a true protein |
Species Leishmania major [TaxId:347515] [255968] (3 PDB entries) |
Domain d3tq0a1: 3tq0 A:1-312 [249976] Other proteins in same PDB: d3tq0a2, d3tq0b2 automated match to d3c61a_ complexed with fmn, fum, gol, ni, so4 |
PDB Entry: 3tq0 (more details), 1.9 Å
SCOPe Domain Sequences for d3tq0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tq0a1 c.1.4.1 (A:1-312) automated matches {Leishmania major [TaxId: 347515]} mslqvnllnntfanpfmnaagvmcttteelvamtesasgslvsksctpalregnptpryq alplgsinsmglpnngfdfylayaaeqhdygkkplflsmsglsmrenvemckrlaavate kgvilelnlscpnvpgkpqvaydfdamrqcltavsevyphsfgvkmppyfdfahfdaaae ilnefpkvqfitcinsignglvidaetesvvikpkqgfgglggryvlptalaninafyrr cpgklifgcggvytgedaflhvlagasmvqvgtalqeegpsiferltsellgvmakkryq tldefrgkvrtl
Timeline for d3tq0a1: