Lineage for d3tkpe_ (3tkp E:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2485379Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2485823Protein automated matches [190100] (20 species)
    not a true protein
  7. 2486109Species Human (Homo sapiens) [TaxId:9606] [187259] (20 PDB entries)
  8. 2486187Domain d3tkpe_: 3tkp E: [249928]
    automated match to d1qmva_

Details for d3tkpe_

PDB Entry: 3tkp (more details), 2.49 Å

PDB Description: crystal structure of full-length human peroxiredoxin 4 in the reduced form
PDB Compounds: (E:) Peroxiredoxin-4

SCOPe Domain Sequences for d3tkpe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tkpe_ c.47.1.10 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hlskakiskpapywegtavidgefkelkltdyrgkylvfffypldftfvcpteiiafgdr
leefrsintevvacsvdsqfthlawintprrqgglgpiripllsdlthqiskdygvyled
sghtlrglfiiddkgilrqitlndlpvgrsvdetlrlvqafqytdkhgevcpagwkpgse
tiipdpagklkyfdkl

SCOPe Domain Coordinates for d3tkpe_:

Click to download the PDB-style file with coordinates for d3tkpe_.
(The format of our PDB-style files is described here.)

Timeline for d3tkpe_: