![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
![]() | Protein Cholera toxin [50208] (1 species) barrel, partly opened; n*=5, S*=10 |
![]() | Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries) Uniprot P01556 22-124 |
![]() | Domain d1eeih_: 1eei H: [24989] complexed with gaa |
PDB Entry: 1eei (more details), 2 Å
SCOPe Domain Sequences for d1eeih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eeih_ b.40.2.1 (H:) Cholera toxin {Vibrio cholerae [TaxId: 666]} tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman
Timeline for d1eeih_:
![]() Domains from other chains: (mouse over for more information) d1eeid_, d1eeie_, d1eeif_, d1eeig_ |