Class b: All beta proteins [48724] (178 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (8 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d3t0aa5: 3t0a A:731-1023 [249644] Other proteins in same PDB: d3t0aa1, d3t0aa2, d3t0aa3, d3t0aa4, d3t0ab1, d3t0ab2, d3t0ab3, d3t0ab4, d3t0ac1, d3t0ac2, d3t0ac3, d3t0ac4, d3t0ad1, d3t0ad2, d3t0ad3, d3t0ad4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3t0a (more details), 1.9 Å
SCOPe Domain Sequences for d3t0aa5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t0aa5 b.30.5.0 (A:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvteatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t0aa5:
View in 3D Domains from same chain: (mouse over for more information) d3t0aa1, d3t0aa2, d3t0aa3, d3t0aa4 |