Class b: All beta proteins [48724] (176 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
Protein automated matches [226849] (4 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
Domain d3t09c5: 3t09 C:731-1023 [249634] Other proteins in same PDB: d3t09a1, d3t09a2, d3t09a3, d3t09a4, d3t09b1, d3t09b2, d3t09b3, d3t09b4, d3t09c1, d3t09c2, d3t09c3, d3t09c4, d3t09d1, d3t09d2, d3t09d3, d3t09d4 automated match to d1jz8a4 complexed with 149, dms, mg, na |
PDB Entry: 3t09 (more details), 1.75 Å
SCOPe Domain Sequences for d3t09c5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3t09c5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndigvaeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3t09c5:
View in 3D Domains from same chain: (mouse over for more information) d3t09c1, d3t09c2, d3t09c3, d3t09c4 |