SCOPe 2.04: Domain d3sp8b3: 3sp8 B:211-289

Lineage for d3sp8b3 (3sp8 B:211-289)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57458] (8 PDB entries)

8. Domain d3sp8b3: 3sp8 B:211-289 [249549]
   Other proteins in same PDB: d3sp8a1, d3sp8b1
   automated match to d1bhta2
   complexed with mes, mpd, mrd, so4

Details for d3sp8b3

PDB Entry: 3sp8, 1.86 Å

PDB Description: Crystal structure of NK2 in complex with fractionated Heparin DP10

PDB Compounds: (B:) Hepatocyte growth factor alpha chain

SCOPe Domain Sequences for d3sp8b3:

Sequence; same for both SEQRES and ATOM records:

>d3sp8b3 g.14.1.1 (B:211-289) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens) [TaxId: 9606]}
cmtsngesyrglmdhtesgkicqrwdhqtphrhkflperypdkgfddnycrnpdgqprpw
cytldphtrweyckiktck

Timeline for d3sp8b3:

• d3sp8b3 is new in SCOPe 2.04-stable
  
• d3sp8b3 appears in SCOPe 2.05
  
• d3sp8b3 appears in the current release, SCOPe 2.08