SCOPe 2.07: Domain d3sioi1: 3sio I:1-208

Lineage for d3sioi1 (3sio I:1-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d3sioi1: 3sio I:1-208 [249484]
   Other proteins in same PDB: d3sioa2, d3siob2, d3sioc2, d3siod2, d3sioe2, d3siof2, d3siog2, d3sioh2, d3sioi2, d3sioj2
   automated match to d2c9ta_
   complexed with bma, man, mlk, mpd, mrd, nag

Details for d3sioi1

PDB Entry: 3sio, 2.32 Å

PDB Description: ac-achbp ligand binding domain (not including beta 9-10 linker) mutated to human alpha-7 nachr

PDB Compounds: (I:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3sioi1:

Sequence; same for both SEQRES and ATOM records:

>d3sioi1 b.96.1.0 (I:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvylsfslldivkadsstnevdlvyweqqsw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqnalvnssghvqylpa
qrlsfmcdptgvdseegatcavkfgswsyggweidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Timeline for d3sioi1:

• d3sioi1 first appeared in SCOPe 2.04, called d3sioi_
  
• d3sioi1 appears in SCOPe 2.06
  
• d3sioi1 appears in the current release, SCOPe 2.08