| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily) unusual fold |
Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) ![]() |
| Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins) |
| Protein Succinate dehydogenase [82818] (2 species) |
| Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries) |
| Domain d3sfea2: 3sfe A:274-360 [249428] Other proteins in same PDB: d3sfea1, d3sfea3, d3sfeb1, d3sfeb2, d3sfec_, d3sfed_ automated match to d1zoya2 complexed with f3s, fad, fes, hem, oaa, sf4, tmg |
PDB Entry: 3sfe (more details), 2.81 Å
SCOPe Domain Sequences for d3sfea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sfea2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq
lavrlpgisetamifagvdvtkepipv
Timeline for d3sfea2:
View in 3DDomains from other chains: (mouse over for more information) d3sfeb1, d3sfeb2, d3sfec_, d3sfed_ |