Lineage for d3sfea2 (3sfe A:274-360)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001328Protein Succinate dehydogenase [82818] (3 species)
  7. 3001347Species Pig (Sus scrofa) [TaxId:9823] [254824] (5 PDB entries)
  8. 3001348Domain d3sfea2: 3sfe A:274-360 [249428]
    Other proteins in same PDB: d3sfea1, d3sfea3, d3sfeb1, d3sfeb2, d3sfec_, d3sfed_
    automated match to d1zoya2
    complexed with f3s, fad, fes, hem, oaa, sf4, tmg

Details for d3sfea2

PDB Entry: 3sfe (more details), 2.81 Å

PDB Description: crystal structure of porcine mitochondrial respiratory complex II bound with oxaloacetate and thiabendazole
PDB Compounds: (A:) Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial

SCOPe Domain Sequences for d3sfea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sfea2 d.168.1.1 (A:274-360) Succinate dehydogenase {Pig (Sus scrofa) [TaxId: 9823]}
gilinsqgerfmeryapvakdlasrdvvsrsmtleiregrgcgpekdhvylqlhhlppeq
lavrlpgisetamifagvdvtkepipv

SCOPe Domain Coordinates for d3sfea2:

Click to download the PDB-style file with coordinates for d3sfea2.
(The format of our PDB-style files is described here.)

Timeline for d3sfea2: