SCOPe 2.04: Domain d3seva_: 3sev A:

Lineage for d3seva_ (3sev A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein D-maltodextrin-binding protein, MBP [53862] (5 species)
   contains a few additional helices in the C-terminal extension; homologous to thiaminase I

7. Species Escherichia coli [TaxId:562] [53863] (62 PDB entries)
   Uniprot P02928

8. Domain d3seva_: 3sev A: [249417]
   automated match to d3pgfa_
   complexed with cl, mal, zn

Details for d3seva_

PDB Entry: 3sev, 3.05 Å

PDB Description: zn-mediated trimer of maltose-binding protein e310h/k314h by synthetic symmetrization

PDB Compounds: (A:) Maltose-binding periplasmic protein

SCOPe Domain Sequences for d3seva_:

Sequence; same for both SEQRES and ATOM records:

>d3seva_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]}
kieegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdii
fwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkd
llpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikd
vgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskv
nygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplg
avalksyehelahdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdaa
laaaqtnaaa

Timeline for d3seva_:

• d3seva_ is new in SCOPe 2.04-stable
  
• d3seva_ appears in SCOPe 2.05
  
• d3seva_ appears in the current release, SCOPe 2.08, called d3seva1