Lineage for d3sepc5 (3sep C:731-1023)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2052444Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2052583Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2053055Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2053056Protein automated matches [226849] (7 species)
    not a true protein
  7. 2053066Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries)
  8. 2053101Domain d3sepc5: 3sep C:731-1023 [249411]
    Other proteins in same PDB: d3sepa1, d3sepa2, d3sepa3, d3sepa4, d3sepb1, d3sepb2, d3sepb3, d3sepb4, d3sepc1, d3sepc2, d3sepc3, d3sepc4, d3sepd1, d3sepd2, d3sepd3, d3sepd4
    automated match to d1jz8a4
    complexed with dms, mg, na

Details for d3sepc5

PDB Entry: 3sep (more details), 2.05 Å

PDB Description: e. coli (lacz) beta-galactosidase (s796a)
PDB Compounds: (C:) beta-galactosidase

SCOPe Domain Sequences for d3sepc5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sepc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvaeatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk

SCOPe Domain Coordinates for d3sepc5:

Click to download the PDB-style file with coordinates for d3sepc5.
(The format of our PDB-style files is described here.)

Timeline for d3sepc5: