SCOPe 2.02: Domain d1ltth_: 1ltt H:

Lineage for d1ltth_ (1ltt H:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Heat-labile toxin [50205] (2 species)

7. Species Escherichia coli, type IB [TaxId:562] [50206] (21 PDB entries)

8. Domain d1ltth_: 1ltt H: [24939]
   Other proteins in same PDB: d1ltt.1

Details for d1ltth_

PDB Entry: 1ltt, 2.3 Å

PDB Description: lactose binding to heat-labile enterotoxin revealed by x-ray crystallography

PDB Compounds: (H:) heat-labile enterotoxin, subunit b

SCOPe Domain Sequences for d1ltth_:

Sequence; same for both SEQRES and ATOM records:

>d1ltth_ b.40.2.1 (H:) Heat-labile toxin {Escherichia coli, type IB [TaxId: 562]}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

Timeline for d1ltth_:

• d1ltth_ first appeared (with stable ids) in SCOP 1.55
  
• d1ltth_ appears in SCOPe 2.01
  
• d1ltth_ appears in SCOPe 2.03
  
• d1ltth_ appears in the current release, SCOPe 2.08