Class g: Small proteins [56992] (92 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries) |
Domain d3sata3: 3sat A:239-274 [249323] Other proteins in same PDB: d3sata1, d3sata2 automated match to d1r2za3 protein/DNA complex; complexed with gol, zn; mutant |
PDB Entry: 3sat (more details), 2.15 Å
SCOPe Domain Sequences for d3sata3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sata3 g.39.1.8 (A:239-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} lyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d3sata3: