Lineage for d3sata3 (3sat A:239-274)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2262247Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2262248Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2262634Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. 2262635Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. 2262636Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries)
  8. 2262651Domain d3sata3: 3sat A:239-274 [249323]
    Other proteins in same PDB: d3sata1, d3sata2
    automated match to d1r2za3
    protein/DNA complex; complexed with gol, zn; mutant

Details for d3sata3

PDB Entry: 3sat (more details), 2.15 Å

PDB Description: mutm slanted complex 6 with r112a mutation
PDB Compounds: (A:) DNA glycosylase

SCOPe Domain Sequences for d3sata3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sata3 g.39.1.8 (A:239-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
lyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d3sata3:

Click to download the PDB-style file with coordinates for d3sata3.
(The format of our PDB-style files is described here.)

Timeline for d3sata3: